PDB entry 1bcf

View 1bcf on RCSB PDB site
Description: the structure of a unique, two-fold symmetric, haem-binding site
Deposited on 1993-12-06, released 1994-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bcfa_
  • Chain 'B':
    Domains in SCOP 1.57: d1bcfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcfA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcfB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg