PDB entry 1bcc

View 1bcc on RCSB PDB site
Description: cytochrome bc1 complex from chicken
Class: oxidoreductase
Keywords: ubiquinone, oxidoreductase, redox enzyme, membrane protein, respiratory chain, electron transport
Deposited on 1998-03-23, released 1998-08-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.27
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13272
      • conflict (22)
      • conflict (58)
      • conflict (71)
      • conflict (90)
      • conflict (105)
      • conflict (134-135)
      • conflict (146)
      • conflict (161)
      • conflict (173)
      • conflict (187)
      • conflict (190)
      • conflict (202)
      • conflict (205)
      • conflict (209)
      • conflict (216)
      • conflict (218-220)
      • conflict (224)
      • conflict (232)
      • conflict (241)
      • conflict (266)
      • conflict (281)
      • conflict (287)
      • conflict (289)
      • conflict (298)
      • conflict (310)
      • conflict (314-315)
      • conflict (319)
      • conflict (321-322)
      • conflict (327)
      • conflict (348-349)
      • conflict (359)
      • conflict (381)
      • conflict (392)
      • conflict (396)
      • conflict (398)
      • conflict (405)
      • conflict (414)
      • conflict (424)
    Domains in SCOPe 2.04: d1bcca1, d1bcca2
  • Chain 'B':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23004 (0-421)
      • conflict (8)
      • conflict (10)
      • conflict (24)
      • conflict (26)
      • conflict (28)
      • conflict (31)
      • conflict (43)
      • conflict (81)
      • conflict (99)
      • conflict (116)
      • conflict (121)
      • conflict (127)
      • conflict (134)
      • conflict (139)
      • conflict (156)
      • conflict (170)
      • conflict (176)
      • conflict (189)
      • conflict (200)
      • conflict (205)
      • conflict (222)
      • conflict (239)
      • conflict (248)
      • conflict (264)
      • conflict (303)
      • conflict (314)
      • conflict (317)
      • conflict (334)
      • conflict (337-338)
      • conflict (349)
      • conflict (362)
      • conflict (375)
      • conflict (394)
      • conflict (402-403)
      • conflict (418)
    Domains in SCOPe 2.04: d1bccb1, d1bccb2
  • Chain 'C':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1bccc2, d1bccc3
  • Chain 'D':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00125 (0-240)
      • conflict (16)
      • conflict (142)
      • conflict (166)
      • conflict (215)
      • conflict (220)
    Domains in SCOPe 2.04: d1bccd2, d1bccd3
  • Chain 'E':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13272 (0-195)
      • conflict (8)
      • conflict (16-19)
      • conflict (25)
      • conflict (28-30)
      • conflict (41)
      • conflict (44)
      • conflict (55)
    Domains in SCOPe 2.04: d1bcce1, d1bcce2
  • Chain 'F':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00129 (Start-108)
      • conflict (28)
      • conflict (37)
      • conflict (58)
      • conflict (68)
      • conflict (86-87)
      • conflict (107)
    Domains in SCOPe 2.04: d1bccf_
  • Chain 'G':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13271
      • conflict (12)
      • conflict (24)
      • conflict (33)
      • conflict (37)
      • conflict (40)
      • conflict (52)
      • conflict (57)
      • conflict (77)
    Domains in SCOPe 2.04: d1bccg_
  • Chain 'H':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00126 (Start-77)
      • conflict (58)
    Domains in SCOPe 2.04: d1bcch_
  • Chain 'I':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1BCC (0-32)
  • Chain 'J':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00130 (Start-61)
      • conflict (29)
    Domains in SCOPe 2.04: d1bccj_
  • Heterogens: BOG, HEM, FES, U10, PEE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bccA (A:)
    tayyaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyfle
    hlafkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqnc
    sledsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsra
    dlteylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsq
    irhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavt
    nklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknf
    lrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcp
    avagpgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccA (A:)
    yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
    fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
    dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
    eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsqirh
    redglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavtnkl
    cqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknflrn
    alvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcpava
    gpgpieqlpdynrirsgmfwlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrglnatsslyqavakgvhnpfdvsafnasys
    dsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvesseg
    fleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvd
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrgnpfdvsafnasysdsglfgfytisqaaya
    gqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvessegfleevgsqalaagsyn
    ppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvdel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bccC (C:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccC (C:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccD (D:)
    sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccE (E:)
    shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bccF (F:)
    agrpavsassrwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmf
    rikraldlnmrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccF (F:)
    srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
    mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bccG (G:)
    grqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllyt
    wgtqefekskrknpaayvndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccG (G:)
    rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
    gtqefekskrknpaayvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bccH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfd
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
    lfnslk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1bccJ (J:)
    vaptltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccJ (J:)
    tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk