PDB entry 1bc9

View 1bc9 on RCSB PDB site
Description: cytohesin-1/b2-1 sec7 domain, nmr, minimized average structure
Class: exchange factor
Keywords: exchange factor, integrin binding protein
Deposited on 1998-05-06, released 1999-05-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytohesin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: B2-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15438 (1-199)
      • conflict (192-198)
    Domains in SCOPe 2.01: d1bc9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bc9A (A:)
mknmqrnkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdyl
gerdefniqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcn
ngvfqstdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnly
esiknepfkipelehhhhhh