PDB entry 1bc8

View 1bc8 on RCSB PDB site
Description: structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.67: d1bc8c_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bc8C (C:)
    mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
    ralryyyvkniikkvngqkfvykfvsypeilnm