PDB entry 1bc8

View 1bc8 on RCSB PDB site
Description: structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Domains in SCOP 1.55: d1bc8c_

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bc8C (C:)
  mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
  ralryyyvkniikkvngqkfvykfvsypeilnm