PDB entry 1bc7

View 1bc7 on RCSB PDB site
Description: serum response factor accessory protein 1a (sap-1)/DNA complex
Class: transcription/DNA
Keywords: ets domain, DNA-binding domain, winged helix-turn-helix, crystal structure, DNA-binding specificity, complex (DNA-binding protein/DNA), transcription/DNA complex
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*gp*ap*cp*ap*gp*gp*ap*tp*gp*tp*g)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*cp*ap*cp*ap*tp*cp*cp*tp*gp*tp*c)-3')
  • Chain 'C':
    Compound: protein (ets-domain protein)
    Species: Homo sapiens [TaxId:9606]
    Gene: SAP-1 RESIDUES 1-93
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bc7c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bc7C (C:)
mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
ralryyyvkniikkvngqkfvykfvsypeilnm