PDB entry 1bc6

View 1bc6 on RCSB PDB site
Description: 7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures
Deposited on 1998-05-05, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1bc6__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bc6_ (-)
  ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
  peewksyiqknrdffkk