PDB entry 1bc5

View 1bc5 on RCSB PDB site
Description: chemotaxis receptor recognition by protein methyltransferase cher
Class: complex (methyltransferase/peptide)
Keywords: methyltransferase, peptide binding, chemotaxis receptor, complex (methyltransferase/peptide)
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis receptor methyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bc5a1, d1bc5a2
  • Chain 'T':
    Compound: chemotaxis receptor
    Database cross-references and differences (RAF-indexed):
    • PDB 1BC5 (Start-4)
  • Heterogens: CO, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bc5A (A:)
mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmlea
nqnsaewqafinalttnltaffreahhfpilaeharrrhgeyrvwsaaastgeepysiai
tladalgmapgrwkvfasdidtevlekarsgiyrlselktlspqqlqryfmrgtgphegl
vrvrqelanyvefssvnllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvpllkpd
gllfaghsenfsnlvrefslrgqtvyals

  • Chain 'T':
    No sequence available.