PDB entry 1bc4

View 1bc4 on RCSB PDB site
Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures
Class: hydrolase
Keywords: hydrolase, phosphoric diester, rc-RNAse, cytotoxic protein, sialic acid binding lectin
Deposited on 1998-05-05, released 1998-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease
  Species: Rana catesbeiana [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11916 (1-110)
  Domains in SCOPe 2.02: d1bc4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bc4A (A:)
  enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
  lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp