PDB entry 1bc4

View 1bc4 on RCSB PDB site
Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures
Deposited on 1998-05-05, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-28, with a file datestamp of 1998-10-28.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bc4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bc4_ (-)
    enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
    lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp