PDB entry 1bc4

View 1bc4 on RCSB PDB site
Description: the solution structure of a cytotoxic ribonuclease from the oocytes of rana catesbeiana (bullfrog), nmr, 15 structures
Class: hydrolase
Keywords: hydrolase, phosphoric diester, rc-RNAse, cytotoxic protein, sialic acid binding lectin
Deposited on 1998-05-05, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bc4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bc4A (A:)
    enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
    lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp