PDB entry 1bc2

View 1bc2 on RCSB PDB site
Description: zn-dependent metallo-beta-lactamase from bacillus cereus
Deposited on 1997-04-11, released 1998-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bc2a_
  • Chain 'B':
    Domains in SCOP 1.57: d1bc2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bc2A (A:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc2A (A:)
    tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
    ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
    nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
    sienvlkryrninavvpghgevgdkglllhtldllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bc2B (B:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc2B (B:)
    tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
    ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
    nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
    sienvlkryrninavvpghgevgdkglllhtldllk