PDB entry 1bc2

View 1bc2 on RCSB PDB site
Description: zn-dependent metallo-beta-lactamase from bacillus cereus
Class: hydrolase
Keywords: hydrolase, metallo beta-lactamase, penicillinase, antibiotic resistance
Deposited on 1997-04-11, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase II
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bc2a_
  • Chain 'B':
    Compound: metallo-beta-lactamase II
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bc2b_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bc2A (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc2A (A:)
    tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
    ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
    nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
    sienvlkryrninavvpghgevgdkglllhtldllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bc2B (B:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc2B (B:)
    tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
    ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
    nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
    sienvlkryrninavvpghgevgdkglllhtldllk