PDB entry 1bc0

View 1bc0 on RCSB PDB site
Description: recombinant rat annexin v, w185a mutant
Class: calcium-binding protein
Keywords: calcium binding protein, phospholipid membrane binding protein, calcium-binding protein
Deposited on 1998-05-04, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14668 (1-318)
      • engineered (184)
    Domains in SCOPe 2.07: d1bc0a_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bc0A (A:)
    malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
    rdlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
    raikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqa
    gelkagtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvk
    sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcggedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc0A (A:)
    alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
    dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
    aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
    elkagtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
    irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
    tsgdykkallllcggedd