PDB entry 1bbz

View 1bbz on RCSB PDB site
Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Deposited on 1998-04-28, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bbza_
  • Chain 'C':
    Domains in SCOP 1.55: d1bbzc_
  • Chain 'E':
    Domains in SCOP 1.55: d1bbze_
  • Chain 'G':
    Domains in SCOP 1.55: d1bbzg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzA (A:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzC (C:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzE (E:)
alfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvas

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbzG (G:)
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns