PDB entry 1bbx

View 1bbx on RCSB PDB site
Description: non-specific protein-DNA interactions in the sso7d-DNA complex, nmr, 1 structure
Class: DNA binding protein/DNA
Keywords: protein-DNA interaction, nonspecific protein-DNA interaction, complex (DNA-binding protein/DNA), DNA binding protein/DNA complex
Deposited on 1998-04-24, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*cp*tp*ap*gp*cp*gp*cp*gp*cp*tp*ap*g)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*cp*tp*ap*gp*cp*gp*cp*gp*cp*tp*ap*g)-3')
  • Chain 'C':
    Compound: DNA-binding protein 7d
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39476 (0-62)
      • conflict (12)
    Domains in SCOPe 2.06: d1bbxc_
  • Chain 'D':
    Compound: DNA-binding protein 7d
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39476 (0-62)
      • conflict (12)
    Domains in SCOPe 2.06: d1bbxd_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbxC (C:)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbxD (D:)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qkk