PDB entry 1bbx

View 1bbx on RCSB PDB site
Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
Deposited on 1998-04-24, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.55: d1bbxc_
  • Chain 'D':
    Domains in SCOP 1.55: d1bbxd_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbxC (C:)
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bbxD (D:)
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk