PDB entry 1bbw

View 1bbw on RCSB PDB site
Description: lysyl-trna synthetase (lyss)
Deposited on 1998-04-24, released 2000-11-10
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-10, with a file datestamp of 2000-11-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.252
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bbwA (A:)
    vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
    grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
    ktgelsihctelrlltkalrplpdkfhglqdqearyrqryldlisndesrntfkvrsqil
    sgirqfmvnrgfmevetpmmqvipggaaarpfithhnaldldmylriapelylkrlvvgg
    fervfeinrnfrnegisvrhnpeftmmelymayadykdlielteslfrtlaqdilgktev
    tygdvtldfgkpfekltmreaikkyrpetdmadldnfdsakaiaesigihvekswglgri
    vteifeevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfseln
    daedqaqrfldqvaakdagddeamfydedyvtalehglpptaglgigidrmvmlftnsht
    irdvilfpamrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbwA (A:)
    vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
    grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
    ktgelsihctelrlltkalrplpdqearyrqryldlisndesrntfkvrsqilsgirqfm
    vnrgfmevetpmmqvipaarpfithhnaldldmylriapelylkrlvvggfervfeinrn
    frnegisvhnpeftmmelymayadykdlielteslfrtlaqdilgktevtygdvtldfgk
    pfekltmreaikkyrpetdmadldnfdsakaiaesigihvekswglgrivteifeevaea
    hliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfselndaedqaqrfld
    qvydedyvtalehglpptaglgigidrmvmlftnshtirdvilfpamrp