PDB entry 1bbu

View 1bbu on RCSB PDB site
Description: lysyl-tRNA synthetase (lyss) complexed with lysine
Class: ligase
Keywords: ligase, aminoacyl-tRNA synthetase, protein biosynthesis
Deposited on 1998-04-24, released 2000-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.228
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysyl-tRNA synthetase)
    Species: Escherichia coli [TaxId:83333]
    Gene: LYSS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bbua1, d1bbua2
  • Heterogens: LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bbuA (A:)
    seqhaqgadavvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneel
    ealnievavagrmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdi
    lgakgklfktktgelsihctelrlltkalrplpdkfhglqdqearyrqryldlisndesr
    ntfkvrsqilsgirqfmvnrgfmevetpmmqvipggaaarpfithhnaldldmylriape
    lylkrlvvggfervfeinrnfrnegisvrhnpeftmmelymayadykdlielteslfrtl
    aqdilgktevtygdvtldfgkpfekltmreaikkyrpetdmadldnfdsakaiaesigih
    vekswglgrivteifeevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggr
    eigngfselndaedqaqrfldqvaakdagddeamfydedyvtalehglpptaglgigidr
    mvmlftnshtirdvilfpamrpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbuA (A:)
    vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
    grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
    ktgelsihctelrlltkalrplpddqearyrqryldlisndesrntfkvrsqilsgirqf
    mvnrgfmevetpmmqvipggaaarpfithhnaldldmylriapelylkrlvvggfervfe
    inrnfrnegisvrhnpeftmmelymayadykdlielteslfrtlaqdilgktevtygdvt
    ldfgkpfekltmreaikkyrpetdmadldnfdsakaiaesigihvekswglgrivteife
    evaeahliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfselndaedqa
    qrfldqvaakdagddeamfydedyvtalehglpptaglgigidrmvmlftnshtirdvil
    fpamrp