PDB entry 1bbs

View 1bbs on RCSB PDB site
Description: x-ray analyses of peptide inhibitor complexes define the structural basis of specificity for human and mouse renins
Class: aspartic proteinase
Keywords: aspartic proteinase
Deposited on 1992-05-21, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbsa_
  • Chain 'B':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bbsA (A:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbsA (A:)
    ttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfd
    asdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefd
    gvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdselggqivlggsdpqhyegn
    fhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealgak
    krlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipppt
    gptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bbsB (B:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbsB (B:)
    ttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfd
    asdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefd
    gvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdselggqivlggsdpqhyegn
    fhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealgak
    krlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipppt
    gptwalgatfirkfytefdrrnnrigfalar