PDB entry 1bbo

View 1bbo on RCSB PDB site
Description: high-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Deposited on 1992-05-01, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1bbo_ (-)
kyiceecgirxkkpsmlkkhirthtdvrpyhctycnfsfktkgnltkhmkskahskk

    Sequence, based on observed residues (ATOM records): (download) 
    >1bbo_ (-)
kyiceecgirkkpsmlkkhirthtdvrpyhctycnfsfktkgnltkhmkskahskk