PDB entry 1bbo

View 1bbo on RCSB PDB site
Description: high-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1992-05-01, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human enhancer-binding protein mbp-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15822 (0-56)
    • conflict (10)
  Domains in SCOPe 2.08: d1bboa1, d1bboa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bboA (A:)
  kyiceecgirakkpsmlkkhirthtdvrpyhctycnfsfktkgnltkhmkskahskk