PDB entry 1bbl

View 1bbl on RCSB PDB site
Description: three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of escherichia coli
Class: glycolysis
Keywords: glycolysis
Deposited on 1992-02-20, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrolipoamide succinyltransferase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07016
  Domains in SCOPe 2.08: d1bbla_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1bblA (A:)
  yasleeqnndalspairrllaehnldasaikgtgvggrltredvekhlaka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1bblA (A:)
  lspairrllaehnldasaikgtgvggrltredvekhl