PDB entry 1bbj

View 1bbj on RCSB PDB site
Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-04-30, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.176
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg4-kappa b72.3 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAG39978 (0-210)
      • conflict (2-3)
      • conflict (10)
      • conflict (12)
      • conflict (14)
      • conflict (17)
      • conflict (23)
      • conflict (26-27)
      • conflict (29-31)
      • conflict (39)
      • conflict (47)
      • conflict (52)
      • conflict (69-70)
      • conflict (72)
      • conflict (75)
      • conflict (79)
      • conflict (83)
      • conflict (89-92)
      • conflict (102)
      • conflict (108-109)
      • conflict (113)
    Domains in SCOP 1.75: d1bbja1, d1bbja2
  • Chain 'B':
    Compound: igg4-kappa b72.3 fab (heavy chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bbjb1, d1bbjb2
  • Chain 'H':
    Compound: igg4-kappa b72.3 fab (heavy chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bbjh1, d1bbjh2
  • Chain 'L':
    Compound: igg4-kappa b72.3 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAG39978 (0-210)
      • conflict (2-3)
      • conflict (10)
      • conflict (12)
      • conflict (14)
      • conflict (17)
      • conflict (23)
      • conflict (26-27)
      • conflict (29-31)
      • conflict (39)
      • conflict (47)
      • conflict (52)
      • conflict (69-70)
      • conflict (72)
      • conflict (75)
      • conflict (79)
      • conflict (83)
      • conflict (89-92)
      • conflict (102)
      • conflict (108-109)
      • conflict (113)
    Domains in SCOP 1.75: d1bbjl1, d1bbjl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjA (A:)
    diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikradaaptvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjB (B:)
    evqlqqsdaelvkpgasvkisckasgytftdhaihwakqkpeqglewigyispgnddiky
    nekfkgkatltadkssstaymqlnsltsedsavyfckrsyyghwgqgttltvssastkgp
    svfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtktytcnvdhkpsntkvdkrv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjH (H:)
    evqlqqsdaelvkpgasvkisckasgytftdhaihwakqkpeqglewigyispgnddiky
    nekfkgkatltadkssstaymqlnsltsedsavyfckrsyyghwgqgttltvssastkgp
    svfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtktytcnvdhkpsntkvdkrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjL (L:)
    diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikradaaptvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr