PDB entry 1bbi

View 1bbi on RCSB PDB site
Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution
Class: hydrolase inhibitor
Keywords: serine protease inhibitor, hydrolase inhibitor
Deposited on 1991-09-19, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin/chymotrypsin bowman-birk inhibitor
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bbia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbiA (A:)
    ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
    pckpseddken