PDB entry 1bbd

View 1bbd on RCSB PDB site
Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-05-05, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 8f5 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAB53774 (0-217)
      • conflict (12)
      • conflict (15)
      • conflict (23)
      • conflict (31)
      • conflict (34)
      • conflict (50)
      • conflict (56)
      • conflict (58-59)
      • conflict (62)
      • conflict (64)
      • conflict (71)
      • conflict (81-82)
      • insertion (96-100)
      • conflict (101-105)
      • conflict (109)
      • conflict (112)
      • conflict (117)
    Domains in SCOP 1.73: d1bbdh1, d1bbdh2
  • Chain 'L':
    Compound: igg2a-kappa 8f5 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA72671 (0-End)
      • conflict (11)
      • conflict (13-14)
      • conflict (17)
      • conflict (21)
      • conflict (32-33)
      • conflict (37)
      • conflict (39)
      • conflict (48)
      • conflict (55)
      • conflict (79)
      • conflict (82)
      • conflict (96-98)
    Domains in SCOP 1.73: d1bbdl1, d1bbdl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bbdH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbdH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1bbdL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbdL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne