PDB entry 1bbd

View 1bbd on RCSB PDB site
Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2
Deposited on 1992-05-05, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bbdH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbdH (H:)
    evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
    dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssak
    ttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1bbdL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bbdL (L:)
    divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne