PDB entry 1bb9

View 1bb9 on RCSB PDB site
Description: crystal structure of the sh3 domain from rat amphiphysin 2
Deposited on 1998-04-29, released 1998-06-17
The last revision prior to the SCOP 1.57 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1bb9__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bb9_ (-)
  ttgrldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesd
  wnqhkelekcrgvfpenftervq