PDB entry 1bb9

View 1bb9 on RCSB PDB site
Description: crystal structure of the sh3 domain from rat amphiphysin 2
Class: transferase
Keywords: transferase, sh3 domain
Deposited on 1998-04-29, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amphiphysin 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bb9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bb9A (A:)
    mgsshhhhhhssglvprgshmatvngavegstttgrldlppgfmfkvqaqhdytatdtde
    lqlkagdvvlvipfqnpeeqdegwlmgvkesdwnqhkelekcrgvfpenftervq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bb9A (A:)
    ttgrldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesd
    wnqhkelekcrgvfpenftervq