PDB entry 1bb8

View 1bb8 on RCSB PDB site
Description: n-terminal DNA binding domain from tn916 integrase, nmr, 25 structures
Class: integrase
Keywords: integrase, DNA binding, transposition
Deposited on 1998-04-29, released 1998-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: integrase
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22886 (0-70)
  Domains in SCOPe 2.06: d1bb8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bb8A (A:)
  ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
  kiaelqkdihd