PDB entry 1bb8

View 1bb8 on RCSB PDB site
Description: n-terminal DNA binding domain from tn916 integrase, nmr, 25 structures
Class: integrase
Keywords: integrase, DNA binding, transposition
Deposited on 1998-04-29, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bb8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb8A (A:)
    ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
    kiaelqkdihd