PDB entry 1bb4

View 1bb4 on RCSB PDB site
Description: human lysozyme double mutant a96l, w109h
Class: hydrolase
Keywords: hydrolase, lysozyme, glycosidase
Deposited on 1998-04-28, released 1998-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.249
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (95)
      • engineered (108)
      • conflict (95)
    Domains in SCOPe 2.06: d1bb4a_
  • Chain 'B':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (95)
      • engineered (108)
      • conflict (95)
    Domains in SCOPe 2.06: d1bb4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb4A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirahvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb4B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirahvawrnrcqnrd
    vrqyvqgcgv