PDB entry 1bay

View 1bay on RCSB PDB site
Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme
Class: transferase
Keywords: transferase, multigene family
Deposited on 1996-11-02, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase class pi
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19157 (0-208)
      • conflict (9-10)
      • conflict (88)
      • conflict (103)
      • conflict (105)
      • conflict (108)
    Domains in SCOPe 2.08: d1baya1, d1baya2
  • Chain 'B':
    Compound: glutathione s-transferase class pi
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19157 (0-208)
      • conflict (9-10)
      • conflict (88)
      • conflict (103)
      • conflict (105)
      • conflict (108)
    Domains in SCOPe 2.08: d1bayb1, d1bayb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bayA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bayA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtqlpkfedgdltlyqsnailrhlgrsl
    glygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqn
    qggkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflssp
    ehvnrpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bayB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bayB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtiqlpkfedgdltlyqsnailrhlgrs
    lglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsq
    nqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflss
    pehvnrpingngkq