PDB entry 1bax

View 1bax on RCSB PDB site
Description: mason-pfizer monkey virus matrix protein, nmr, average structure
Class: matrix protein
Keywords: matrix protein, core protein, polyprotein, myristylation
Deposited on 1998-04-20, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: m-pmv matrix protein
  Species: Mason-Pfizer monkey virus [TaxId:11855]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07567 (0-93)
  Domains in SCOPe 2.08: d1baxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1baxA (A:)
  mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
  dcfqdyyntfgpekvpvtafsywnlikelidkke