PDB entry 1bav

View 1bav on RCSB PDB site
Description: carboxypeptidase a complexed with 2-benzyl-3-iodo-propanoic acid (bip)
Class: carboxypeptidase
Keywords: hydrolase, carboxypeptidase, zinc, zymogen, signal
Deposited on 1996-11-14, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-End)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1bava_
  • Chain 'B':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-End)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1bavb_
  • Chain 'C':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-End)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1bavc_
  • Chain 'D':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-End)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1bavd_
  • Heterogens: ZN, BIP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bavA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bavA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bavB (B:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bavB (B:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bavC (C:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bavC (C:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bavD (D:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bavD (D:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn