PDB entry 1bar

View 1bar on RCSB PDB site
Description: three-dimensional structures of acidic and basic fibroblast growth factors
Class: growth factor
Keywords: growth factor
Deposited on 1992-09-29, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
      • conflict (92)
    Domains in SCOPe 2.06: d1bara_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968 (0-End)
      • conflict (46)
      • conflict (92)
    Domains in SCOPe 2.06: d1barb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1barA (A:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleengyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1barA (A:)
    pkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdtd
    gllygsqtpneeclflerleengyntyiskkhaekhwfvglkkngrsklgprthfgqkai
    lflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1barB (B:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleengyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1barB (B:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleengyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvs