PDB entry 1baq

View 1baq on RCSB PDB site
Description: antitermination factor nusb from escherichia coli, nmr, 18 structures
Class: transcription termination
Keywords: transcription termination, antitermination factor
Deposited on 1998-04-17, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitermination factor nusb
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: NUSB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1baqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1baqA (A:)
    mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
    yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
    kfvngvldkaapvirpnkk