PDB entry 1bao

View 1bao on RCSB PDB site
Description: the contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Class: endonuclease
Keywords: endonuclease
Deposited on 1993-05-19, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (77)
    Domains in SCOPe 2.07: d1baoa_
  • Chain 'B':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (77)
    Domains in SCOPe 2.07: d1baob_
  • Chain 'C':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (77)
    Domains in SCOPe 2.07: d1baoc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1baoA (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1baoA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1baoB (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1baoB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1baoC (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1baoC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir