PDB entry 1bam

View 1bam on RCSB PDB site
Description: structure of restriction endonuclease bamhi phased at 1.95 angstroms resolution by mad analysis
Class: endonuclease
Keywords: endonuclease
Deposited on 1994-12-28, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ENDONUCLEASE BamH I
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bama_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bamA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bamA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpidvykefienselkrvgmefetgnissahrsmnklllglkh
    geidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfnaeaynsnvplipk
    gsdgmskrsikkwkdkvenk