PDB entry 1bal

View 1bal on RCSB PDB site
Description: three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of (escherichia coli)
Class: glycolysis
Keywords: glycolysis
Deposited on 1992-02-20, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide succinyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bala_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1balA (A:)
yasleeqnndalspairrllaehnldasaikgtgvggrltredvekhlaka