PDB entry 1baj

View 1baj on RCSB PDB site
Description: hiv-1 capsid protein c-terminal fragment plus gag p2 domain
Class: Viral protein
Keywords: CAPSID, HIV-1 ASSEMBLY PROTEIN, Viral protein
Deposited on 1998-04-17, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1baja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bajA (A:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvlaeamsqvtnpatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bajA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtac