PDB entry 1bai

View 1bai on RCSB PDB site
Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor
Deposited on 1998-04-17, released 1999-01-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1baia_
  • Chain 'B':
    Domains in SCOP 1.65: d1baib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1baiA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
    npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
    ltnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1baiB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
    npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
    ltnl