PDB entry 1bai

View 1bai on RCSB PDB site
Description: Crystal structure of Rous sarcoma virus protease in complex with inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEIN-MEDIATED INTERACTION, VIRAL MATURATION, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-04-17, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.175
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92805 (0-123)
      • variant (37)
      • variant (41)
      • variant (43)
      • variant (72)
      • variant (99)
      • variant (103)
      • conflict (104-105)
      • variant (106)
    Domains in SCOPe 2.07: d1baia_
  • Chain 'B':
    Compound: Protease
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92805 (0-123)
      • variant (37)
      • variant (41)
      • variant (43)
      • variant (72)
      • variant (99)
      • variant (103)
      • conflict (104-105)
      • variant (106)
    Domains in SCOPe 2.07: d1baib_
  • Heterogens: 0Q4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1baiA (A:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
    npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
    ltnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1baiB (B:)
    lamtmehkdrplvrviltntgshpvkqrsvyitalldtgaddtviseedwptdwpvmeaa
    npqihgigggipvrksrdmielgvinrdgslerplllfplvamtpvnilgrdclqglglr
    ltnl