PDB entry 1bah

View 1bah on RCSB PDB site
Description: a two disulfide derivative of charybdotoxin with disulfide 13-33 replaced by two alpha-aminobutyric acids, nmr, 30 structures
Class: toxin
Keywords: charybdotoxin, neurotoxin, potassium channel inhibitor, toxin
Deposited on 1996-06-06, released 1997-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: charybdotoxin
    Species: Leiurus quinquestriatus [TaxId:6883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13487 (1-36)
      • modified residue (12)
      • modified residue (32)
    Domains in SCOPe 2.08: d1baha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bahA (A:)
    eftnvscttskeawsvcqrlhntsrgkcmnkkarcys