PDB entry 1bag

View 1bag on RCSB PDB site
Description:
Deposited on 1998-01-30, released 1998-10-21
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-21, with a file datestamp of 1998-10-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1bag_1, d1bag_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bag_ (-)
    ltapsiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwyw
    lyqptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnw
    thgntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakh
    ielpddgsygsqfwpnitntsaefqygqilqdsasrdaayanymdvtasnyghsirsalk
    nrnlgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgst
    plffsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmagqpeelsnpngnnq
    ifmnqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvndgkltgtinarsva
    vlypd