PDB entry 1baf

View 1baf on RCSB PDB site
Description: 2.9 angstroms resolution structure of an anti-dinitrophenyl-spin-label monoclonal antibody fab fragment with bound hapten
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-01-16, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa an02 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAB06744 (0-216)
      • conflict (17)
      • conflict (28)
      • conflict (31)
      • conflict (48)
      • conflict (51-52)
      • conflict (58)
      • conflict (64)
      • conflict (83)
      • conflict (94)
      • conflict (98)
      • insertion (100)
      • conflict (101)
      • conflict (109)
      • conflict (111)
      • conflict (114)
      • conflict (188-189)
    Domains in SCOP 1.75: d1bafh1, d1bafh2
  • Chain 'L':
    Compound: igg1-kappa an02 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAC28911 (2-212)
      • conflict (16)
      • conflict (20)
      • conflict (29-32)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (45)
      • conflict (51)
      • conflict (54)
      • conflict (58)
      • conflict (75)
      • conflict (83)
      • conflict (85)
      • conflict (87)
      • insertion (93)
      • conflict (95)
      • conflict (99)
    Domains in SCOP 1.75: d1bafl1, d1bafl2
  • Heterogens: NPP

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bafH (H:)
    dvqlqesgpglvkpsqsqsltctvtgysitsdyawnwirqfpgnklewmgymsysgstry
    npslrsrisitrdtsknqfflqlksvttedtatyfcargwplaywgqgtqvsvseakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bafL (L:)
    qivltqspaimsaspgekvtmtcsasssvyymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltisrmeaedaatyycqqwssyppitfgvgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec