PDB entry 1baf

View 1baf on RCSB PDB site
Description:
Deposited on 1992-01-16, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bafh1, d1bafh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bafl1, d1bafl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bafH (H:)
    dvqlqesgpglvkpsqsqsltctvtgysitsdyawnwirqfpgnklewmgymsysgstry
    npslrsrisitrdtsknqfflqlksvttedtatyfcargwplaywgqgtqvsvseakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bafL (L:)
    qivltqspaimsaspgekvtmtcsasssvyymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltisrmeaedaatyycqqwssyppitfgvgtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec