PDB entry 1baa

View 1baa on RCSB PDB site
Description: crystal structure of an endochitinase from hordeum vulgare l. seeds
Deposited on 1992-11-18, released 1993-10-31
The last revision was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1baa_ (-)
    svssivsraqfdrmllrrndgacqakgfytydafvaaaaafpgfgttgsadaqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvgfktaiwfwmtaqppkpsshaviagqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa
    

  • Chain 'p':
    No sequence available.