PDB entry 1ba9

View 1ba9 on RCSB PDB site
Description: the solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Class: oxidoreductase
Keywords: oxidoreductase, superoxide dismutase, copper-zinc enzyme, dismutation of uperoxide radicals to molecular oxygen and hydrogen peroxide
Deposited on 1998-04-24, released 1998-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 1998-09-16, with a file datestamp of 2007-07-06.
Experiment type: NMR36
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: superoxide dismutase
  Species: HOMO SAPIENS
  Gene: HSOD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
    • engineered (5)
    • engineered (49-50)
    • engineered (110)
    • engineered (132)
  Domains in SCOP 1.75: d1ba9a_
• Heterogens: ZN, CU1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ba9A (A:)
  atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
  ekaddlgkggneqstktgnagsrlacgvigiaq