PDB entry 1ba9

View 1ba9 on RCSB PDB site
Description: the solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Class: oxidoreductase
Keywords: oxidoreductase, superoxide dismutase, copper-zinc enzyme, dismutation of uperoxide radicals to molecular oxygen and hydrogen peroxide
Deposited on 1998-04-24, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: superoxide dismutase
  Species: Homo sapiens [TaxId:9606]
  Gene: HSOD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
    • engineered (5)
    • engineered (49-50)
    • engineered (110)
    • engineered (132)
  Domains in SCOPe 2.08: d1ba9a_
• Heterogens: ZN, CU1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ba9A (A:)
  atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
  ekaddlgkggneqstktgnagsrlacgvigiaq